/hoc/

imagine posting early threads

lick the goddamned bench you loser

Attached: 8.png (1280x796, 1.24M)

Other urls found in this thread:

youtube.com/watch?v=MvGfYu4gOlQ
en.wikipedia.org/wiki/Rover_(ice_hockey)
cvl-demos.cs.nott.ac.uk/vrn/
youtu.be/qx_5pEyJbho
youtube.com/watch?v=3RY5mvSkpIk
youtu.be/0V0kcKxpRHM
is.fi/nhl/art-2000006239200.html?utm_campaign=tf-IS&utm_term=1&utm_source=tf-other
youtube.com/watch?v=2_0q_CXl41s
twitter.com/MarcAndreBerset/status/1172892825320599552?s=19
twitter.com/SFWRedditVideos

Shallst.

1 second early. hard shant.

How do you say "based retard" in Maori?

CALL
THE
MOUN-TIES
>*clap clap clapclapclap*

fuck the knights

What language do they speak in the Shire?

>imagine posting early threads
>posts an early thread
S A G E

Attached: 1557288916471.jpg (1200x906, 92K)

why are you like this

Attached: 1558533314212.png (420x449, 75K)

>9 posts
>5 posters
stop samefagging you pathetic faggot

Attached: bl.png (400x400, 278K)

>half a dozen /hoc/ threads
Does any other general do this?

No other generals are as chad as /hoc/

Attached: 4dnamUd.png (483x664, 768K)

youtube.com/watch?v=MvGfYu4gOlQ

I think we might be secretly retarded.

Attached: hy.jpg (1000x1000, 101K)

>secretly

Attached: based1.jpg (960x819, 126K)

>tegan and sara
take me back to 2005-2007 pls

thinking about benis

:DDD

Attached: based4.jpg (594x396, 120K)

wazzup my wiggers

finna play with my penis

I just had a fap lads

that was fast

Kirby "CTE" Dach

Attached: Mugabe.jpg (700x550, 189K)

>kevin crappenshit

Attached: shatt_free_agency_1920x1080_942553667949.jpg (656x369, 26K)

i would like to speak with the boss of /hoc/ please

Attached: lw5.png (1276x718, 1.01M)

>he can't fap in 4 seconds

Attached: smug alien.gif (600x450, 1.24M)

It's bait. He's not gonna do it...

thinkin about $7mil AAV based boeser burger

Thing is when the NHL was still very much young, the players were often working factory jobs in the summer just to make ends meet. If you're going to put something out to market, such as women's hockey, people actually have to be willing to pay to watch it. If people aren't paying, then it's not going to be self sustaining. I'm passionate about music, but if I'm not getting paid, I'm not playing. Plain and simple. If nobody wants to give money to me to play for them, then obviously they're not valuing what I'm doing.

If it's all about passion for them, then they can work a day job that pays their bills, and volunteer their time, while having basic things like food, travel costs, hotels for out of town games. The guys in the AIHL aren't paid professionals. Why? Because next to nobody watches it aside from /hoc/ and the families of the players.

>le boeser alliteration meme
>le sharks o6
>le beav
>le onion ring
fags

yeah, i need to work on that

Attached: 1354235525086.jpg (425x307, 18K)

im fine with 3/4

pretty much this. bobby hull was one of the first players to make $1m/year and that didnt happen until around 1972. even ignoring inflation, the nhl existed for a long time where the players werent being paid that well and had to work in the offseason.

>If it's all about passion for them, then they can work a day job that pays their bills, and volunteer their time, while having basic things like food, travel costs, hotels for out of town games when they are playing.
ftfm

>COVERED for them while they're playing.
God the whiskey is good tonight.

They don't mind working. Most of them hold hockey camps as a way to make extra income so they would still do that. My point is that they really care about the future of hockey in this country and elsewhere. It's not going to be an easy road but they have decided as players to walk it together and make life better for those down the road. Not too dissimilar to Ted Lindsay starting the NHLPA, which was pivotal in allowing the players to have a say in how they get treated. Your point about the AIHL is apt as well, they play for the love of it which I feel is undervalued

Gonna hit they hay lads. Hoping it'll be a nice 8 hour slumber, but it'll probably be a 3-4 hour nap. :(

>stopped drinking years ago
>occasional here and there
>insomnia worse than ever lately
>pour some vodka tonight
Oh god how i remember how this used to get me in trouble, and the copious amounts i used to drink. not sure how to feel really

is michigan the only college that good at hokkei and handegg?

Based COOMER

Attached: coombrain.jpg (2059x1669, 2.26M)

I also feel they want the feminist angle to die off. They wake up every morning, head on twitter after their morning workout and see cat ladies fighting over whether the NWHL is a viable league (it isn't) or calling several NHL players "rapists". Even worse is if a potential fan of womens hockey heads onto twitter to check it out and see's nothing but social outcasts trying to out-cunt eachother. that doesn't help grow the game at all, what I did was find footage of these players doing what they do best and show it on twitter using my knowledge I have gotten from /hoc/ . I don't want to toot my own horn but I feel I've done more in the last 20 days to grow women's hockey than the average feminist ever could. They NEED real hockey fans to take an interest and the feminists to just fuckoff

if i go to nyc as a hasb fan and lick the bench then hasb will win the stan lee, right?

dubs confirm

the only person to control your actions is you lad

thinking about spuds

not sure about this one la

:/

thinking about spurdo

marinara

wil /hoc/ get the 444444 tonight?

i come back to see this as i filled another glass
It doesn't happen often anymore, but if it does for some reason become a habit again (it wont), you have permission to heem me

Attached: 1520820088896.jpg (457x752, 42K)

meet me at the spike if you feel like lahey lad

>My point is that they really care about the future of hockey in this country and elsewhere.
The future of hockey is fine. In fact, it's more than fine. Nations that never even thought about icing a team even 15 years ago are doing it now. It's more of women's players wanting to catch up to the men's players in terms of salary. People are always going to pay to see the top performers. When it comes to physical sports, or athletics in general, men are going to get the most attention. Why? Because they break the most records, and produce some of the most awe-inspiring moments. Plus, their physiology is far more suited for physical stress/endeavours. Men's players nowadays train far more vigorously than their counterparts from 50 years ago, and the guys back then could still whoop any women's team these days.

They're just going to have to settle for being paid less than AHL players. That's if people will actually pay to see them play. It's a pretty hard sell when there's little to no physical contact, and the general skill level is below the minor men's league.

Yep, it’s the Kings year.

one of my favorite movies of all time is The Misfits, but i can only watch it while drinking or drunk

/hoc/autists be wrting fucking novels, disregarding 444444

That’s one of my favorite bands while drinking or drunk. Really brings out the teen angst.

>i say fuck authority
>silent majority

Saw them live at warped tour some many moons ago.

>real drunk as hell east coast hours

real dude hours

not gonna lie, i kinda dig the canada-usa banter

Just woke up ama

Probably because your banter is only worth CAD 75¢ on the real dollar.

saying this as a frog tbqhwyf

first movie that come to mind when i say "overrated"

your banter is worth 0$usd m8

My friend is in Calgary, is there something he can get me?

what's the best item on mcdicks menu ans why is it Filet O' Fish

some boots. a hat.

I agree wholeheartedly with you. The number 1 goal for the women is to first get a league that is viable, then they can work on the $$$ aspect. They are all smart & kind people just asking for a little help from the NHL with scheduling icetimes and I feel especially after the recent allstar game, they have earned atleast a shot.

Still enough to get me a québécois whore and a Molson

$$$ makes it viable. They need to work on offering something that people actually want to pay to watch.

yes you're right. life isn't a charity

Attached: EmmaNordin.webm (1920x1048, 2.99M)

Attached: Darnell Nurse_April 2nd 2019.webm (1280x720, 2.93M)

Attached: 80b8977928f09089afb25fa3c689b6d0f51fdf6e_00.jpg (500x373, 26K)

Attached: Brent Burns hits Matt Calvert.webm (1280x720, 2.97M)

Attached: Mikko Rantanen PP goal.webm (1280x720, 3M)

...

Attached: Stars-Wild.webm (1280x720, 1.77M)

>wake up
>brew a steaming cup of juhla mokka coffee
>open hocgeneral.com
>see 10 /hoc/'s in the catalog
>remember that bulju plays tonight
maximum comfiness

Attached: kiärpät.png (400x321, 87K)

seizure warning for this one. tons of camera flashes

Attached: Carl Soderberg-SH_Dec6th2018.webm (1280x720, 3M)

hope he does well, I am rooting for him. s the game available for free anywhere? I can make webms of it if you'd like

Attached: Pulju.webm (1280x720, 2.94M)

still get chills watching this. This is what the game is about, those moments that make you glad you are a fan

Attached: ovi.webm (640x360, 2.99M)

Attached: Afinogenov.webm (960x540, 2.88M)

onhockey usually have streams from almost all leagues

Attached: Chara.webm (1280x720, 2.31M)

ok nice. I only knew about sports24 until then

Can you guys seriously not stop being faggots for 2 goddamn seconds.

Really want to eat pussy and ass, lads.

Attached: ReneBourqueHit.webm (1280x720, 522K)

>almost all
and finnish league is the one no one has. at least past seasons

bit gay

Why are finns so gay, lads? Is it because their women don't shave their pussies?

I will endeavour to find it my friend and get Bulju webms for us to enjoy

>just remembered I made a webm a year ago of CWHL hockey with Cosco cricket cup commentary

I am retarded and fucking weird

t. eats pussy
if you suck pussy, youll suck anything

Oh, never mind, he's just a virgin. He doesn't even know how to eat pussy. Lmaoooooooooooooooooooooooooooooooo

Attached: 1567646741925.jpg (1510x2002, 235K)

didn't mean to reply to you and finnish women are hot

Attached: 1565029584731_dreamtime2.png (512x512, 429K)

She looks like it's very bushy down there, user

question how many of you saw the fritzl vids I made.

how about some hits

Attached: larsson.webm (1280x720, 2.75M)

Attached: Hickey hits Lucic.webm (1280x720, 2.99M)

Is the formation with 3 forwards and 2 backs unchangeable? Were there teams playin with 4 backs?

Attached: Ovechkin hits Chara.webm (1280x720, 2.74M)

>sad tits
>doughy body
She's far from hot. She's like a reverse butter face.

sure. The torpedo system exists where you switch the left defender for a forward usually someone with speed that can cycle the puck. Thats the system Calgary Inferno employed and they were probably the greatest women's club team in history

but if you are talking about the NHL and other high level leagues, no. Its way too risky now to play without 2 players on structured defense. In the old days the term was rover for someone without a set position. read more here
en.wikipedia.org/wiki/Rover_(ice_hockey)

You often see teams playing 4 forwards and 1 defender on power play

this too but it seemed commonsense

a passport

Yeah, it's kind of basic knowledge. But I thought I'd throw it in there just in case

I think it is easier to emigrate to Canada than to us, isn't it? I know both french and english, so your natives are going to accept me I think.

smart lad

Attached: DonCherry.webm (275x270, 395K)

laine better be signed by tomorrow

Honestly, I'm kind of basic when it comes to hockey knowledge myself

I'd be fine with cleaning NHL officials toilets to get Łyszczarczyk to play there. I'd that with toothbrush if Knights would've sign him.

and thats ok. hockey is for everyone

im still sipping vodka. last few sips tho. Don't know how some of you do this nightly. Trust me, It'll hurt exponentially more as you get older. Not looking forward to tomorrow

based friendly saturday comfy poster

site to make these. turns 2d image into 3d

cvl-demos.cs.nott.ac.uk/vrn/

gonna try to get the ovechkin hits jagr one for /hoc/ as well

memes aside, how do you think Panarin will fare in NYC with the >rags?

Thinking of joining my sister company and write money gibbs from EU for other people starting their own companies. I dont know shit about it but she will try to teach me.

Attached: Scheifele.webm (1280x720, 2.84M)

syön persettä

checked
and i do also (female)

ok currently interpolating it from 25fps to 60. should be smooth as butter and easier on the eyes than salma hayek

used to slay pussy in my younger years, took time off to get my life right in my 30s. Relationship not a part of any of that, Doing good now but, man i get lonely sometimes boys

Hot take:

Marner is worth his contract and Nylander is worth half of his contract at best FUCK nylander

Who are the best hitters in the league left now that the old guard has retired, Larsson was second or so in hits last season I think. what about big buf?

not sure if Marner is worth THAT much, but agree about Nylander

Pretty sure hitting is illegal now

Hot take:

Marner is overvalued, but kneelander is gonna hit 70+ points this season if he gets some minutes on pp.

I know some of you aren't absolute boomers like me, but look how much hitting and physical play has changed in just the last decade or so.
The shit I grew up watching would be criminal now

Just woke up. Brewing some coffee then off to play some puck.

Nylander is a show pony
Marner is a player

Learn the difference

It might save your life one day

dont see it happening, but not saying it couldn't happen either

Agreed, and it's bullshit. Society as a whole needs to get the sand out of its collective vagina.

he had two 60 point season before last seasons shitshow, I mean of course it depends on what kind of minutes and line mates he gets, but since he got something to prove now I think he'll produce.

When I was a lad Darian Hatcher was a legitimate NHL defenseman

clutterbuck still throws a mean hit. for defense I'd say byfuglien

Attached: Byfuglien destroys Koivu.webm (1280x720, 2.96M)

an issue is that the game is faster now, so firstly hitting is less beneficial and the same sort of hits are more dangerous. I do miss it though, that's why Kronwalls retirement felt like "the end of an era" just because he was one of the few delivering players delivering hits left.

can i come bro

Attached: 1566416134639.jpg (686x942, 69K)

agreed

you play a CONTACT sport. You know what you're getting into when you play it. They shouldn't have to change the rules regarding physicality just because one or a few get hurt. It's unfortunate but its part of the game.

AND, anyone who has ever actually played the game knows, that the code is real. Enforcer did, and should have a place in hockey. They kept superstars from becoming smears on the boards

Contracts if dubass wasn't a twink faggot with no backbone:
Marner - 9m/ 7 years
Nylander - 8m/ 8 years sign and trade for two 1st and a 2nd to some gullible retards
Matthews - 10.5m/ 8 years
Tavares - 11m/ 6 years

not him, but pepe's are always welcome

The NHL regular season is kind of void of contact now but the playoffs are where it really gets going.

another good hitter is Zadorov

Attached: Zadorov's hit on Athanasiou.webm (1280x720, 2.98M)

business idea: put coffee in a camelback and sip while playing puck

I was going to say zadorov. Ovechkin is unironically the leagues biggest hitter

Attached: Douglas Murray.webm (1920x1080, 1.94M)

the stick glitching is annoying af but here you go. 60fps

Attached: Ovechkin hits Jagr - 2010 Olympics.webm (960x540, 2.91M)

Oops, pretty sure that's not Douglas Murray. That's a bad file name

You're not wrong re: speed reducing physical play. Following that line of reasoning, it was really the legalization of the two-line pass that started off this whole trend.

>t. GM that keeps spamming his results on nhl 16 be a GM mode

that Anna Borgqvist. she plays in the SDHL for HV71.

Attached: AnnaBorgqvistWinsFaceoffThenDeflectsPuckToScore (1).webm (1920x1080, 2.77M)

so who's gonna offer sheet Connor?

>rags

faster version

Attached: Jagr2.webm (960x540, 2.99M)

with 1.1M in cap space? and i dont think anyone is going to pay more than the 8.4M because that would be two first rounders

>Larsson was second or so in hits last season I think
correction, second among swedes, ninth overall

only 6 more years of parise + suter

Lmfao holy shit Minnesota is gay as fuck hahahaha

You post hits only. Post some dodges as well please.

Drinking pepsi max straight out of the bottle, also lmaoing at laffs

Will Kaprizov save mild?

dont sleep on the habs

I'll try to find some. if you know of any just shout them out

sign mikko pls

Attached: 7c89f899.jpg (1134x763, 171K)

I called Wonderboy and asked him about the 94 million. He said it was in Canadian dollars and was actually under cap. I told him the bad news and he started screaming about twinks and hung up.

YES!!!

Attached: Mikko Rantanen 2nd Goal (2).webm (1280x720, 2.98M)

>2 day old chicken egg shit

I've watched not enough game last season to remember those.

thats ok. i'll check youtube and NHL.com for some

Attached: 3498d86e0595de4b4f2897b7930bcfddbccd1ef2_s1_n2.png (948x740, 1.44M)

Is Dubas the worst GM in the league currently?

no but he did overpay nylander

this is you

Attached: very pretty leaf.jpg (581x800, 56K)

he overpaid all 3 of his best players lmao

t. dickless wonder

If the dollar always fluctuates then why doesn't a hockey team wait until gold is cheap and juts pay their players in gold?

*sips*

bulju in eta 3 hours finnish time

>Could we speak to the manager?

Attached: Monique Lamoureux - 2010 Olympics.webm (960x540, 2.89M)

just realized its 5:30 in the morning. i am sleepy af

youtu.be/qx_5pEyJbho
Top comfy winter activity

Looked like near death at 2:30

Like 10 cm from front collision with tree/ post

Attached: scared bubbles.gif (300x225, 485K)

youtube.com/watch?v=3RY5mvSkpIk

its womens hockey but its hockey. Shenzhen KRS vanke rays playing russian team. not sure which

SHL starts in one hour fäm

>tfw your teams game gets postponed 3 hours cause the Sharia state of Malmö can't afford working planes for their team so they take an an emergency plane from Legoland

Attached: Legoland.png (649x427, 527K)

cool. just linked it in case anyone needed hockey to watch

CWHL lives on!

this was tegan and sarah the whole time?
here i thought it was a couple random lesbians

rock hard right now

yay but not really. roster is quite different. don't have nearly as much depth now. Bunton, Mercer, Miller and Wong are all gone

*sips*

sign mikko now

just woke up. 5.5 hours aint bad

You'll be fine. Try to get some restful sleeps tonight though

Attached: 1540441143849.jpg (450x600, 61K)

>misfits
>teen angst
Not really, maybe literally any other punk band though.

cricket

Attached: wr3ffrf32qw.png (1078x1346, 1.77M)

Imagine living your whole life as a happy turku boy and then getting drafted by the fucking >rags

How is it even possible an original 6 franchise only won 4 cups?

I'm gonna drink 6 pints of beer and watch some Liiga soon. Life is good and comfy.

NIGGER

t. USA

hmm...

NIGGER

No, u the nigger

can't decide which one I like better

Attached: Heritage Classic 2019.png (500x275, 336K)

4-5 hours is a normal amount of sleep.

I was watching a youtube video about goalies and then I come across this simpleton

Attached: Screenshot from 2019-09-14 08-04-07.png (715x104, 10K)

how my wild gonna go this year boys?

Like fucking bunch of crap shit bro

at least i have the juniors and world championship to look forward to

Attached: 1469429624082.jpg (601x508, 94K)

both teams came out with really aesthetic jerseys

with jerseys this nice, there's no excuse not to use these all the time.

>my

they could surprise people

by how shitty they are lol

The Mild are the most based central division team.

basedboys

Attached: zach parise takes fan out for ice cream.webm (800x450, 2.98M)

Attached: 1568316638081.jpg (513x580, 139K)

Attached: 1541392403124.jpg (213x256, 7K)

surprise people by ekeing out WC2 and then getting BTFO in the first round maybe

Kys

Attached: basedgif.gif (250x247, 1.6M)

>k-kys bc of your opinion of the coolest team in the worst division
take a look in the mirror retard.

need hoki

Attached: jesse-puljujarvi-tongue-picking-nose.gif (480x263, 2.24M)

Kys

Based carpet munchers

tu du du du

shant be giving phoneposters anymore (You)s lads

got fucked up last night, gonna get absolutely obliterated tonight

give me hokkei, or give me death

Attached: blizzard dev incels.png (313x64, 42K)

slow riffs and bong hits, simple as

Attached: C01C8B7813DFA3E70688EB7075A6364570A9C711.png (462x459, 267K)

let papa show the magic

my friend is gonna get me some hoki gifts from Calgary

did he visit the spike?

Can you tell him to get me a hockey gf

the spike is in winnipeg dumb dumb

based

you should get a cowboy hat

there is always a spike where fags go

based and DUDEpilled

bobs and vagene

SIGN. MIKKO. NOW.

jets

I'm a hockeyholic. for years I've battled an addiction to hockeyhol

I met this guy at bar last night. He told me I look like a faggot. Ain't havin any of that shit, you know?

So, what I do? I stare that motherfucker straight in the eye. Straight. In. The. Eyeball.

I say:"I got two words to you, sonny. You better listen real careful, 'cause I ain't saying them twice. Fuck. Off."

He got the message, Haven't seen from him since then.

All that fuss just because I like to wear a Flyers hoodie.

>blots

No it isn't

based bunland

bulju scored btw

Blood came out when I coughed. Should I be scared /hoc/?

Attached: Screenshot_2019-09-14-16-35-27.png (720x1280, 894K)

isn't Oulu like the north pole of Finland?

Attached: lahti pelicans.png (488x304, 80K)

Good morning, sweetie

just hack a dart you'll be fine bud

I've quit one year ago. Wasn't even a hard smoker. Pack a week.

no its 200km below the arctic circle

>giving a third of your day away to big mattress

hello!

anyone here bet on hockey?

Attached: 1559992127381.jpg (294x171, 10K)

real hockey fans watch real hockey

Imagine how much shitposting could be done in that time

or homosex

or homosex that is

>SHL champs
>BTFO with 0-5 after two first periods
EXPOSED

Attached: C1A363B7-6258-4A84-BE7D-96828060D08A.jpg (4032x3024, 1.18M)

I'm incredibly sad and angry

I wish I could hug you

I on the other hand feel light and free and happy
one might argue that I feel gay
nothing wrong with that, perfectly suitable word for happy

I feel too stupid to work with my sister. How to undumb myself?

Step 1. Don't be Polish
well fuck

Me too Finnbro. Me too.

i smell like feces

tfw hockey soon

Attached: power play.webm (854x480, 815K)

Why

Can't wait.

Attached: lataus (50).jpg (249x202, 7K)

Poland strong

what's gonna be the big hockey news today lads?

Bulju scored

Laine traded to Florida

Andrew Shaw comes out from closet

point offer sheet from columbus

youtu.be/0V0kcKxpRHM

Live scrimmage blue jackets

I can tell you some facts about people in my country if you want to know. Yes, there are many really fucking dumb poles, the kind of people without any empathy or deep thoughts. Those are the people living abroad for 10 years and not learning a single word in foreign language. There is also plenty of people that got rich on scamming people. But on the other hand there is plenty of well educated people, working low paid jobs because they aren't really into leaving their country. There also those really hard working poles that actually suceeded in life, but work drained out their energy. The point is that the difference between dumb ones and the educated is way too huge, there is nothing in between, and the fact that there will always be more dumber people gives our country the opinion we may deserve. Even though I'm studying english philology I know that my english skills sucks, but the fact that people from indonese shoe shining forum can somehow understand what I'm saying really makes my day sometimes.
tl;dr we dumb, we clever, I suck at english. We definitely not so strong

*sips*

wow, it's a nice cup of coffee

Listen man I don't give a fuck about polish hockey but there is something you might be able to help me with

I am a 20-year-old man. My 19-year-old girlfriend and I were having sex in the shower last week, when her aunt, who is in her late 40’s, walked in on us. We ended up having a threesome. I had protected sex with both of them and we all performed oral sex on each other. This women is now asking my girlfriends mother to join us for group sex and she has even agreed to do so. However, I feel this may have consequences. How can I get out of this without breaking up with my girlfriend? I don’t want to hurt her feelings. I have always been considerate to her needs and have never let her down when she has requested me for something. What should I do?

Poland have you heard about this site called www.blogspot.com? I bet you would love it.

Fire up the gas chambers

Well slap my ass and call me sully, a good ol' holocaust is just what we need.

the leafs traded for CODY CECI HAHAHAHAHAHAHAHAHAHAHHAHAHA

I told you, that you can ignore this post
Stop blogging on /hoc/ should be your first step

First they came for the Jews and I said nothing because I'm not a Jew.

Then they came for the blacks and I said nothing because I'm not black.

Then they stopped coming for people because the world was a utopia and humans explored the stars.

Amen, brother.

>tfw >my team will win this year

Attached: 1560439267282.jpg (1644x2046, 367K)

HOLY FUCKING BASED

Go blog about putting screen doors on submarines ya no good fuckin pole fuckin shit

they might win one game

both are very nice but it's flims for me

>imagine being so mad at the letters you see on a screen

the last few days until hokkei returns are the toughest

what about them fags though?

just happened
>taking a bong rip
>notice halfway through theres a fly in the glass tube
>cant abort now
>swallow fly while inhaling smoke
im a frog lol

Disappeared when they came for the jews

don't forget the poles

Today in Poland a plane crashed in a cemetery and the polish authorities have retrieved 4000 bodies

id let him *********** me

Attached: ezgif-5-ffecbeecc5a5.gif (400x225, 2.88M)

free protein

How do you sink a polish battleship? Put it in water.

so happy for him lads

eat the bugs goy

Attached: 1543846821862.gif (226x224, 182K)

wish i had his hair

t. balding virgin

our boy grew up

Rekt

Why doesn't Poland have a hockey team? They all drowned in spring training. (Melted ice lol)

we're all gonna make it

Why do polish names end in ski? They can't spell toboggan

LMFAO

Attached: 501ff47181d866eb8fb8186ec3f83d9d.jpg (515x300, 34K)

Guys.

I think we survived the summer.

Attached: b695c048 (2).jpg (231x231, 8K)

where'd they bury the survivors?

Is there liiga streams somewhere?

Idk but apparently if a pole doesn't pay their garbage bill the garbage man stops delivering

Dont worry, you will get them someday USA

Attached: 1.png (720x222, 29K)

Poles sell their water skis because they can't find a lake with a hill in it, this is not a joke but a sad phenomenon that is bankrupting the country

Q: how do you keep a pole in suspense?

>hi user, wanna come to my place and watch some hockey?

Attached: fe5ba577.jpg (823x1024, 79K)

no

A: you don't answer after he asks 'how?'
Looks like my 3rd gf

yes
do you have telia

>you should have said yes...

Attached: IMG_20190914_184118.jpg (720x899, 159K)

Why does Poland suck at hockey?

They lost the recipe for ice

keep them going, I'm actually laughing out loud (lol)

Polish women are like goalers. They change their pads after three periods.

I used to work with a Polish guy, he would never smile

best one so far kek

gonna fly to poland so I can heem this faggot

Attached: 1546716745520.gif (500x293, 565K)

why would you even think you can win?

Probably because he wanted to rake some fuckin leafs but was scared to climb a tree

just woke up

Attached: [just woke up].webm (540x405, 386K)

shant give polandfaggot any of my precious (You)'s

Poland is a pushover in everything

A Pole walks into a bar. And a table. And a chair.

that is known as Pole on pole violence

Laine went to practise with HC Bern? Upcoming news...

you can say all you want, but this guy really thinks he can win a street fist fight with a slav. lose weight gain height

A Pole slithers into a bar and asks for a beer. The bartender replies, "Sorry, we don't serve your kind here.

Would you?

There was once a Polak who was extremely sad with life because
people always made fun of him. He decided to do something about it. He
sat back and thought about it. Suddenly he thought - "I have never
seen anyone making fun of Italians. So, if I start talking and
behaving like them, no one will be able to make out that I am Polish
and make fun of me." He went into isolation for three months and
after a lot of practice, he walked confidently into a shop and said,
"I am a very hungry. Give me some pepperoni and zucchini."
Immediately, the man behind the counter said "Are you a
Polak?" This guy was taken aback and he repeated his request. The
man behind the counter said, "Are you a Polak or not?"
This man was finally very ashamed and amazed at the shop
owner's discerning ability and so he admitted to the fact after which
he asked, "But how did you know?"
The shopkeeper replied, "This is a hardware store!"

LMFAO GET FUCKED YOU POLE SHIT! Many such cases!

>tfw no Tim Burton gf

It's real!

is.fi/nhl/art-2000006239200.html?utm_campaign=tf-IS&utm_term=1&utm_source=tf-other

youtube.com/watch?v=2_0q_CXl41s

There once was a tranny named randy
He told me that a nigger stole his digger
But when asked to lick the bench
He never took the loss
And licked dicks for the rest of his life

there's a local beetlejuice in every dive bar, just take your pick

I won't make jokes about USA until September ends. I know they are still mourning after something that happened 18 years ago and this is how they cope.

AAHAHAHAHHAHAHAHAHAHAHAHAHAHAHSHSHSHSHHAHAAHHAHASHJAVWVSBSJDHSHWJRKFOFOZLSKFJFJDKXLZOROTOT

*breathes in*

AAHAHAHAHSHSHHSHAHAHAHAHAHAHAHAHHAHWYSVDKSLSPAPENFBXIDÖSMFLFLXNCPCN LÖ COCK FL MDKDK LDMCKCO N MFLDLCN OCK MÖ NCL NSLWJEKEKROCM ÖTITPYPYPJÖBÖJÖJÖJÖKÖJÖJÖJÖJÖJÖJ

lmao FUCK poland

twitter.com/MarcAndreBerset/status/1172892825320599552?s=19

UHOH

Thank you for the link, wish I went down to Nationwide today to watch it live.

Two polish soldiers are just returning from battle in WWII. One finds a severed head and screams "oh no, it's Aleksy!" Another replies "no, Aleksy is much taller"

I mean, these guys are DUMB folks!0

Local beetlejuice ama

Fuck off Ted

>SC Bern

Doesn't he know the Nylander strategy only works if your GM is a weak willed twink?

It's over.

S

Attached: bemarilaine.jpg (984x554, 51K)

Pro tip: if you're concerned about Polish thieves just hide your valuables under a bar of soap.

Oof cringey

thinking of calling poland Paul from now on

poland?.......more like POO land

>going from top league to Swiss league

what a scrub

Attached: buh.png (234x275, 159K)

He's going to get benched in Swiss league too lmfao literally Poland tier

thanks man, these preseason things are easy to miss so a heads up is appreciated

Ted is elite and you are not

Attached: mfw.jpg (1240x775, 84K)

Seriously guys the polish navy puts glass floors in their ships so they can see the old polish navy oh no no no no

YES YES YES

Dont't mind those bullies. I like you.

I stand with poland even though he roots for both the yotes and the knights

You've chosen your side. You are a fool. Poles can never exist peacefully so long as there is hockey. Live with the consequences.

That bar is not /hoc/

KUZNETZOV SUSPENDED THREE GAMES
HOLY SHIT THE COCKSHITON CRAPITALS SEASON IS OVER
OVIE RETIREMENT ANNOUNCEMENT FOLLOWING SHORTLY

Just stroked my ding dong

Attached: mfw.jpg (425x282, 44K)

Fuck off Ted

The truth is, I never was on your side.

Naturally, for I don't exist. I'm just a number. A cog in Gary's machine. A hand pounding the glass. You, however, you exist merely as a tool of polands. I pity you.

hoping for a trade desu
fuck the jest

Pounding on the glass is the true sign of a low IQ tool

You only say that because you prefer pounding ass. Male ass. Burn sinner.

Look around you. Everything you see is a lie. A big fat lie told you by everyone you've ever known. There are no sides, no parts, no life even.

Just us, making the best of in /hoc/.

>t. poorfag whos never been at front row
SEETHE

t. yells SHOOT

I want to unplug from the matrix, I want to see the sunbelt for what it really is. I just don't know how. I'm scared

t. can’t control his emotions ie. a nigger

Go outside

I am scared too. Yet I find comfort here. Were are not alone. We are one.

>says the guy who instantly replied

Attached: bonhomme.png (596x596, 172K)

Attached: mfw.jpg (236x292, 12K)

Attached: iStock_000041128662_Medium.jpg (630x489, 78K)

Are you implying there's such a thing as "inside"? So naive!

I always instantly reply because I’m not a NIGGER

you are all in my imagination, but it's hard to fight nightmares by myself

Attached: mfw.jpg (325x453, 15K)

hello lads everyone's invited

From my point of view, that's all you'll ever be. DISGUSTING.

Calm down son there's no need for that sort of language

Attached: 1550628252917.jpg (613x640, 146K)

nice digits poland

sipping coffee and listening to EYEHATEGODs song called "white nword"

the absolute state of >jest

go outside more

I don’t care what some window licking glass pounder thinks

for me it's depress

Better than being a penis licking ass pounder who can't afford tickets

Learn some self control tyrone

everyone point and laugh

Attached: st louis.png (768x432, 335K)

Is nhl 20 ”same shit different year” again?

Just like my life

Depends if you play franchise mode. That's all I do in those games and it's pretty different but gameplay is the same basically and the scoreboard is on the bottom

>thinking the best seats are right on the glass
Imagine being this wrong

Nice cope Tyrone. It's Father's Day all over again.

Just watched this documentary about squirrels. Interesting shit. Also laine training with bern in switzerland

Attached: 15684789139603647278899828908967.jpg (4128x3096, 1.79M)

bulju 1+1

Mkay so not worth 70 bucks. Might buy when it goes on sale

>st louis blues
>utah jazz
When is Salt Lake City Mumble Rap?

>bangs on glass
>yells SHOOT
>only knows one slur and shouts it over and over
Feel bad for low iq tools like yourself, wish the government would step in and put you out of your misery

Tyrone have you ever noticed the government acts as a surrogate for your absent father?

where can I watch the game finnbro

The sounds, the view, seeing the players closeup, pounding the glass when an opposing team player is smashed into your pane. It's an awesome experience.

i think laine sucks

gonna play some postal 2 lads

Huomenta

I think its bretty gud

Why is it red? There isn't any red at all in their uniform colors or logo.

What happens when you steal a puck that went into the crowd?

>every other team is getting their shitty/nice 90's jerseys back
fisherman soon?

Attached: Billy.gif (300x225, 1.43M)

Telia.fi, only 20 bucks per month to see all Car Parts games

it's a throwback and there's red in the city flag

What were the best/the most memorable 90's hockey jerseys?

That's the way it used to be kotherfucker that's the shit hull, Gretzky, pronger, all them motherfuckers wore that why motherfuck plus they just won the cup so they finna bouta boost some sick nasty cash in merch sales from mark ass suckas

Sheeeit

FUCK YOU EUGENE BRING IT BACK REEEEEEEEEEEEE

Attached: bcc.jpg (679x750, 81K)

Coyotes, the stars jersey that was a star, rangers third jersey

I will make the next thead and take a picture of my ass as pic.

*sips*

Ok very good

These? They had cool logo.

Attached: image-asset.png (960x480, 670K)

I just like how regional they are without being too street hockey ish

jaywalker = rags fan
car = /hoc/

Attached: 1550208380020.webm (720x404, 596K)

Based

t. brainlet
Have sex and kys

Love the dallas jersey. Like their current ones as well

Attached: R2VWXYVV76LW55AF3DL2NWFPME.jpg (1024x880, 124K)

Ouch. RIP.

Tyrone you had 10 minutes and responded with that. That's time you could've spent looking for your father.

The sparkly D logo on their current ones seems really cheap feeling to me but I like the color updates

I have the white one of that, the memories...

those were good jerseys
one of the schools in my state used to use those

Attached: 1539927167657.jpg (540x359, 46K)

shoutenings at laine

what it could've been.....

Attached: Chara islanders.jpg (3072x2016, 650K)

Panthers should bring back the jumping kitty
Sabres should bring back their black jerseys from their run to the finals
Capitals eagle jersey should come back too

I hope the Knights will wear their oldschool jersey this season.

imagine

HEATENINGS

Attached: 1548382889174.jpg (314x364, 25K)

throwbacks for everybody!!

Attached: c3823e0f.jpg (842x842, 230K)

It’s alright lad, I won. Let it go, maybe you’ll get me next time by finding a new way to call me a nigger but I don’t really think you will.

There should be hockey today

>that bowl cut on the kid
fucking kek lil dutch boy lookin ass nigga

comfy is just a code word for boring desu

imagine an islanders with chara and louongo. That would've been incredible back in those days

You're an idiot and I mean that sincerely.

*shits in your hair*

>daveart

Attached: 1554629961896.jpg (600x537, 38K)

i got the next one lads

imagine a senators with chara still

Kys

every day until you learn

no one will stop saying comfy because of an autist

Can’t imagine being worked up into this much of a shoot because someone called you stupid. Whatever, you do you. Thanks for all the free (you)’s, shall be spending them wisely.

What would you think if I told you that Kaapo Kakko is going to be better than McJesus 5 years from now ?

making bacon and then I will fry an egg and a piece of bread in the grease

I would think, “Dumb finns, they never learn do they?”

Kys

desu

be very disturbed from yet another case of finish delusion

Attached: blots.png (479x200, 27K)

dios mio!

Attached: hola.jpg (540x425, 27K)

*AHEM*

Next thread is in the catalog, just waiting for this to hit 500 before posting the link.

what an ugly balding spic

Shan't

will not be posting in it

caps eagle is so so so much better than the shit they have now

Bulju